PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.4G288100.1.p
Common NameLOC101785788, SETIT_006457mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 438aa    MW: 47269.8 Da    PI: 6.5139
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.4G288100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.74.8e-1761105147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         r +WT+eE+e++++a k++G   W+ I +++g ++t+ q++s+ qk+
  Seita.4G288100.1.p  61 REKWTEEEHEKFLEALKLYGRS-WRQIQEHIG-TKTAVQIRSHAQKF 105
                         789*****************55.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.58E-1655109IPR009057Homeodomain-like
PROSITE profilePS5129422.05656110IPR017930Myb domain
TIGRFAMsTIGR015577.0E-1659108IPR006447Myb domain, plants
SMARTSM007171.6E-1460108IPR001005SANT/Myb domain
PfamPF002491.2E-1461104IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-1061101IPR009057Homeodomain-like
CDDcd001671.17E-1163106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009845Biological Processseed germination
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 438 aa     Download sequence    Send to blast
MASMAQVEER DGLDSSGLSI DKRLPLDAVK SPLKDDAVQP KEGMDGYPVK VRKPYTITKQ  60
REKWTEEEHE KFLEALKLYG RSWRQIQEHI GTKTAVQIRS HAQKFFSKVV REPGASNAIE  120
IPPPRPKRKP LHPYPRKCAD SSTLANPAVG QPKLAPISSS SGYNVENGSP VSVLSAMQSD  180
TFGSSVSNPS TGCTSPASSD DGNNAPVLVS EEENLLTQQV EDDQSRQEMK LDNSDGDLSE  240
EDSSGGVQET SLKLFGKTVI IPDPKKVCSS DGGCGDGEKS SQPSKQEVLQ ASSIGGVAAY  300
PTHNGWLLPY HSFQFHMGDS GNARISPLHV WWPYYGFPAG HPRGFSMGLP TEGTCESDTG  360
KSLSAESSSD CLGNVQTTAP TNCKVVKEPL GAIQVPESAL SFELKPSTNS AFARVKPGSS  420
RDHSLRGFMP YKRCKVE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004966527.10.0PREDICTED: uncharacterized protein LOC101785788
TrEMBLK3XWZ90.0K3XWZ9_SETIT; Uncharacterized protein
STRINGSi006457m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP77833647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G37260.12e-41MYB_related family protein